Thymosin Beta 4 2mg (TB500)

Price range: $22.04 through $845.00

Model:Thymosin Beta 4 2mg (TB500)
Molecular Formula:C212H350N56O78S
Research Only:Yes

Quantity

Clear

SKU: N/A Category: Peptides

TB-500 2mg – High-Quality Research Peptide

TB-500, offered at 2mg, is a high-quality specialised research peptide developed for advanced scientific exploration in cellular biology and actin-related signalling pathways. This product is ideal for laboratory settings where precision and reliability are paramount.

Product Name: TB-500 2mg
Catalogue Number: TB500-2mg
Molecular Formula: C212H350N56O78S
Molecular Weight: 4963.4 g/mol
Purity: ≥98%
Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Form: Lyophilised Solid

Storage and Handling:

TB-500 is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. Store the sealed vial at -20°C, protected from light and moisture. All handling and laboratory procedures are determined by the receiving laboratory under its own protocols.

Synthesis and Quality Assurance:

TB-500 is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.

Legal and Safety Information:

Peptides Outlets proudly provides TB-500 strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including TB-500, are not designed for human consumption or clinical application.

If you require high-quality TB-500 for your research in the US, explore our range of peptides designed for scientific rigour and innovation.

Technical Specification

Identification
Molecular Weight (g/mol)	4963.44 g/mol
Peptide Sequence	Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr- Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH
Physical and Chemical Properties
Molecular Formula	C212H350N56O78S
Physical Appearance	White lyophilised solid
Form	Sterile filtered white lyophilized (freeze-dried)
Solubility	Aqueous soluble
Appearance	White to off-white lyophilised powder
Melting Point	Not applicable (decomposes before melting)
Analytical and Quality Control
HPLC Result	Shows min 98% purity
Mass Spectrum	Consistent with structure
Purity %	>98%
Research Use and Safety
Caution	Research use only / Not for human or veterinary use
Intended Use	For laboratory research use only. Not for human or veterinary use.
Hazard Classification	Not classified as hazardous under GHS for research quantities
Storage, Handling and Stability
Storage Temperature, Opened	Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18°C. Upon reconstitution of the peptide it should be stored at 4°C between 2-21 days and for future use below -18°C.
Storage Temperature, Unopened	-20 °C recommended for long-term storage
Shelf Life	2 years unopened under recommended conditions
Reconstitution Stability	Stable for up to 28 days at 2-8 °C in aqueous solution under sterile conditions