Sermorelin (GRF 1-29 ) 2mg

Price range: $16.84 through $333.25

Model:Sermorelin 2mg
Molecular Formula:C149H246N44O42S
Molecular Weight: 3358.9 g/mol
Purity: ≥98%
Research Only:Yes

Quantity

Clear

SKU: N/A Category: Peptides

Sermorelin Acetate 2mg – High-Quality Research Peptide

Sermorelin Acetate, offered at 5mg, is a high-quality specialised research peptide developed for advanced scientific exploration in endocrinology and related fields. This product is ideal for laboratory settings where precision and reliability are paramount.

Product Name: Sermorelin Acetate 2mg
Molecular Formula: C149H246N44O42S
Molecular Weight: 3358.9 g/mol
Purity: ≥98%
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 (acetate salt)
Form: Lyophilised Solid

Storage and Handling:

Sermorelin Acetate is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. Store the sealed vial at -20°C, protected from light and moisture. All handling and laboratory procedures are determined by the receiving laboratory under its own protocols.

Synthesis and Quality Assurance:

Sermorelin Acetate is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.

Legal and Safety Information:

Peptides Outlets proudly provides Sermorelin Acetate strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including Sermorelin Acetate, are not designed for human consumption or clinical application.

If you require high-quality Sermorelin Acetate for your research in the US, explore our range of peptides designed for scientific rigour and innovation.

Technical Specifications

Identification
Molecular Weight (g/mol)	3417.985 g/mol
Physical and Chemical Properties
Molecular Formula	C151H250N44O44S
Physical Appearance	White lyophilised solid
Appearance	White to off-white lyophilised powder
Melting Point	Not applicable (decomposes before melting)
Research Use and Safety
Caution	Research use only / Not for human or veterinary use
Intended Use	For laboratory research use only. Not for human or veterinary use.
Hazard Classification	Not classified as hazardous under GHS for research quantities
Storage, Handling and Stability
Storage Temperature, Opened	Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18°C. Upon reconstitution of the peptide, it should be stored at 4°C between 2-21 days and for future use below -18°C.
Storage Temperature, Unopened	-20 °C recommended for long-term storage
Shelf Life	2 years unopened under recommended conditions
Reconstitution Stability	Stable for up to 28 days at 2-8 °C in aqueous solution under sterile conditions